RegulonDB RegulonDB 10.8: Amino acid Sequence
30S ribosomal subunit protein S20 Amino Acid Sequence


Size: 87

Fasta

 

>30S ribosomal subunit protein S20 E. coli K12. Version NC_000913.3 GI:556503834
MANIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFNEMQPIVDR
QAAKGLIHKNKAARHKANLTAQINKLA
              
                            

Download fasta file
RegulonDB