RegulonDB RegulonDB 10.9: Amino acid Sequence
sulfate/thiosulfate ABC transporter periplasmic binding protein Sbp Amino Acid Sequence


Size: 329

Fasta

 

>sulfate/thiosulfate ABC transporter periplasmic binding protein Sbp E. coli K12. Version NC_000913.3 GI:556503834
MNKWGVGLTFLLAATSVMAKDIQLLNVSYDPTRELYEQYNKAFSAHWKQQTGDNVVIRQS
HGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKEWIKRLPDNSAPYTSTIVFLV
RKGNPKQIHDWNDLIKPGVSVITPNPKSSGGARWNYLAAWGYALHHNNNDQAKAQDFVRA
LYKNVEVLDSGARGSTNTFVERGIGDVLIAWENEALLAANELGKDKFEIVTPSESILAEP
TVSVVDKVVEKKGTKEVAEAYLKYLYSPEGQEIAAKNYYRPRDAEVAKKYENAFPKLKLF
TIDEEFGGWTKAQKEHFANGGTFDQISKR
              
                            

Download fasta file
RegulonDB