RegulonDB RegulonDB 10.8: Amino acid Sequence
Sec translocon accessory complex subunit SecF Amino Acid Sequence


Size: 323

Fasta

 

>Sec translocon accessory complex subunit SecF E. coli K12. Version NC_000913.3 GI:556503834
MAQEYTVEQLNHGRKVYDFMRWDYWAFGISGLLLIAAIVIMGVRGFNWGLDFTGGTVIEI
TLEKPAEIDVMRDALQKAGFEEPMLQNFGSSHDIMVRMPPAEGETGGQVLGSQVLKVINE
STNQNAAVKRIEFVGPSVGADLAQTGAMALMAALLSILVYVGFRFEWRLAAGVVIALAHD
VIITLGILSLFHIEIDLTIVASLMSVIGYSLNDSIVVSDRIRENFRKIRRGTPYEIFNVS
LTQTLHRTLITSGTTLMVILMLYLFGGPVLEGFSLTMLIGVSIGTASSIYVASALALKLG
MKREHMLQQKVEKEGADQPSILP
              
                            

Download fasta file
RegulonDB