RegulonDB RegulonDB 10.9: Amino acid Sequence
tRNA (Gm18) 2'-O-methyltransferase Amino Acid Sequence


Size: 229

Fasta

 

>tRNA (Gm18) 2'-O-methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MNPTRYARICEMLARRQPDLTVCMEQVHKPHNVSAIIRTADAVGVHEVHAVWPGSRMRTM
ASAAAGSNSWVQVKTHRTIGDAVAHLKGQGMQILATHLSDNAVDFREIDYTRPTCILMGQ
EKTGITQEALALADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMYLRENSMLPE
AEQQRLLFEGGYPVLAKVAKRKGLPYPHVNQQGEIEADADWWATMQAAG
              
                            

Download fasta file
RegulonDB