RegulonDB RegulonDB 10.8: Amino acid Sequence
peptidyl-prolyl cis-trans isomerase SurA Amino Acid Sequence


Size: 428

Fasta

 

>peptidyl-prolyl cis-trans isomerase SurA E. coli K12. Version NC_000913.3 GI:556503834
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQL
PDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAY
DGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQNDASTELNLSHIL
IPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELP
GIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNISVTEVHARHILLKPSPIMTD
EQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRL
NKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNRKFSEEAASWMQEQRAS
AYVKILSN
              
                            

Download fasta file
RegulonDB