RegulonDB RegulonDB 10.8: Amino acid Sequence
tRNA-guanine transglycosylase Amino Acid Sequence


Size: 375

Fasta

 

>tRNA-guanine transglycosylase E. coli K12. Version NC_000913.3 GI:556503834
MKFELDTTDGRARRGRLVFDRGVVETPCFMPVGTYGTVKGMTPEEVEATGAQIILGNTFH
LWLRPGQEIMKLHGDLHDFMQWKGPILTDSGGFQVFSLGDIRKITEQGVHFRNPINGDPI
FLDPEKSMEIQYDLGSDIVMIFDECTPYPADWDYAKRSMEMSLRWAKRSRERFDSLGNKN
ALFGIIQGSVYEDLRDISVKGLVDIGFDGYAVGGLAVGEPKADMHRILEHVCPQIPADKP
RYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHLFVTDGVVKIRNAKYKSDTGPLDP
ECDCYTCRNYSRAYLHHLDRCNEILGARLNTIHNLRYYQRLMAGLRKAIEEGKLESFVTD
FYQRQGREVPPLNVD
              
                            

Download fasta file
RegulonDB