RegulonDB RegulonDB 10.9: Amino acid Sequence
DNA-binding transcriptional repressor TrpR Amino Acid Sequence


Size: 108

Fasta

 

>DNA-binding transcriptional repressor TrpR E. coli K12. Version NC_000913.3 GI:556503834
MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
              
                            

Download fasta file
RegulonDB