RegulonDB RegulonDB 10.8: Amino acid Sequence
nucleoside-specific channel-forming protein Tsx Amino Acid Sequence


Size: 294

Fasta

 

>nucleoside-specific channel-forming protein Tsx E. coli K12. Version NC_000913.3 GI:556503834
MKKTLLAAGAVLALSSSFTVNAAENDKPQYLSDWWHQSVNVVGSYHTRFGPQIRNDTYLE
YEAFAKKDWFDFYGYADAPVFFGGNSDAKGIWNHGSPLFMEIEPRFSIDKLTNTDLSFGP
FKEWYFANNYIYDMGRNKDGRQSTWYMGLGTDIDTGLPMSLSMNVYAKYQWQNYGAANEN
EWDGYRFKIKYFVPITDLWGGQLSYIGFTNFDWGSDLGDDSGNAINGIKTRTNNSIASSH
ILALNYDHWHYSVVARYWHDGGQWNDDAELNFGNGNFNVRSTGWGGYLVVGYNF
              
                            

Download fasta file
RegulonDB