RegulonDB RegulonDB 11.1: Amino acid Sequence
UvrABC excision nuclease subunit C Amino Acid Sequence


Size: 610

Fasta

 

>excision nuclease subunit C E. coli K12. Version NC_000913.3 GI:556503834
MSDQFDAKAFLKTVTSQPGVYRMYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALV
AQIQQIDVTVTHTETEALLLEHNYIKLYQPRYNVLLRDDKSYPFIFLSGDTHPRLAMHRG
AKHAKGEYFGPFPNGYAVRETLALLQKIFPIRQCENSVYRNRSRPCLQYQIGRCLGPCVE
GLVSEEEYAQQVEYVRLFLSGKDDQVLTQLISRMETASQNLEFEEAARIRDQIQAVRRVT
EKQFVSNTGDDLDVIGVAFDAGMACVHVLFIRQGKVLGSRSYFPKVPGGTELSEVVETFV
GQFYLQGSQMRTLPGEILLDFNLSDKTLLADSLSELAGRKINVQTKPRGDRARYLKLART
NAATALTSKLSQQSTVHQRLTALASVLKLPEVKRMECFDISHTMGEQTVASCVVFDANGP
LRAEYRRYNITGITPGDDYAAMNQVLRRRYGKAIDDSKIPDVILIDGGKGQLAQAKNVFA
ELDVSWDKNHPLLLGVAKGADRKAGLETLFFEPEGEGFSLPPDSPALHVIQHIRDESHDH
AIGGHRKKRAKVKNTSSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGL
AEKIFWSLKH
              
                            

Download fasta file
RegulonDB