RegulonDB RegulonDB 10.10: Amino acid Sequence
tagaturonate reductase Amino Acid Sequence


Size: 483

Fasta

 

>tagaturonate reductase E. coli K12. Version NC_000913.3 GI:556503834
MKTLNRRDFPGAQYPERIIQFGEGNFLRAFVDWQIDLLNEHTDLNSGVVVVRPIETSFPP
SLSTQDGLYTTIIRGLNEKGEAVSDARLIRSVNREISVYSEYDEFLKLAHNPEMRFVFSN
TTEAGISYHAGDKFDDAPAVSYPAKLTRLLFERFSHFNGALDKGWIIIPCELIDYNGDAL
RELVLRYAQEWALPEAFIQWLDQANSFCSTLVDRIVTGYPRDEVAKLEEELGYHDGFLDT
AEHFYLFVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERKVAILNGAHTALVPVAFQAG
LDTVGEAMNDAEICAFVEKAIYEEIIPVLDLPRDELESFASAVTGRFRNPYIKHQLLSIA
LNGMTKFRTRILPQLLAGQKANGTLPARLTFALAALIAFYRGERNGETYPVQDDAHWLER
YQQLWSQHRDRVIGTQELVAIVLAEKDHWEQDLTQVPGLVEQVANDLDAILEKGMREAVR
PLC
              
                            

Download fasta file
RegulonDB