RegulonDB RegulonDB 10.8: Amino acid Sequence
bifunctional riboflavin kinase / FMN adenylyltransferase Amino Acid Sequence


Size: 313

Fasta

 

>bifunctional riboflavin kinase / FMN adenylyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MKLIRGIHNLSQAPQEGCVLTIGNFDGVHRGHRALLQGLQEEGRKRNLPVMVMLFEPQPL
ELFATDKAPARLTRLREKLRYLAECGVDYVLCVRFDRRFAALTAQNFISDLLVKHLRVKF
LAVGDDFRFGAGREGDFLLLQKAGMEYGFDITSTQTFCEGGVRISSTAVRQALADDNLAL
AESLLGHPFAISGRVVHGDELGRTIGFPTANVPLRRQVSPVKGVYAVEVLGLGEKPLPGV
ANIGTRPTVAGIRQQLEVHLLDVAMDLYGRHIQVVLRKKIRNEQRFASLDELKAQIARDE
LTAREFFGLTKPA
              
                            

Download fasta file
RegulonDB