RegulonDB RegulonDB 10.8: Amino acid Sequence
1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase Amino Acid Sequence


Size: 316

Fasta

 

>1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase E. coli K12. Version NC_000913.3 GI:556503834
MQILLANPRGFCAGVDRAISIVENALAIYGAPIYVRHEVVHNRYVVDSLRERGAIFIEQI
SEVPDGAILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIG
HAGHPEVEGTMGQYSNPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDA
LRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGK
RAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQQLGGGEAIPLEGREENI
VFEVPKELRVDIREVD
              
                            

Download fasta file
RegulonDB