RegulonDB RegulonDB 10.8: Amino acid Sequence
ribonucleoside hydrolase RihC Amino Acid Sequence


Size: 304

Fasta

 

>ribonucleoside hydrolase RihC E. coli K12. Version NC_000913.3 GI:556503834
MRLPIFLDTDPGIDDAVAIAAAIFAPELDLQLMTTVAGNVSVEKTTRNALQLLHFWNAEI
PLAQGAAVPLVRAPRDAASVHGESGMAGYDFVEHNRKPLGIPAFLAIRDALMRAPEPVTL
VAIGPLTNIALLLSQCPECKPYIRRLVIMGGSAGRGNCTPNAEFNIAADPEAAACVFRSG
IEIVMCGLDVTNQAILTPDYLSTLPQLNRTGKMLHALFSHYRSGSMQSGLRMHDLCAIAW
LVRPDLFTLKPCFVAVETQGEFTSGTTVVDIDGCLGKPANVQVALDLDVKGFQQWVAEVL
ALAS
              
                            

Download fasta file
RegulonDB