RegulonDB RegulonDB 10.8: Amino acid Sequence
acyl carrier protein phosphodiesterase Amino Acid Sequence


Size: 193

Fasta

 

>acyl carrier protein phosphodiesterase E. coli K12. Version NC_000913.3 GI:556503834
MNFLAHLHLAHLAESSLSGNLLADFVRGNPEESFPPDVVAGIHMHRRIDVLTDNLPEVRE
AREWFRSETRRVAPITLDVMWDHFLSRHWSQLSPDFPLQEFVCYAREQVMTILPDSPPRF
INLNNYLWSEQWLVRYRDMDFIQNVLNGMASRRPRLDALRDSWYDLDAHYDALETRFWQF
YPRMMAQASRKAL
              
                            

Download fasta file
RegulonDB