RegulonDB RegulonDB 10.8: Amino acid Sequence
Sec translocon accessory complex subunit YajC Amino Acid Sequence


Size: 110

Fasta

 

>Sec translocon accessory complex subunit YajC E. coli K12. Version NC_000913.3 GI:556503834
MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGD
EVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL
              
                            

Download fasta file
RegulonDB