RegulonDB RegulonDB 10.8: Amino acid Sequence
HNH nuclease family protein YajD Amino Acid Sequence


Size: 115

Fasta

 

>HNH nuclease family protein YajD E. coli K12. Version NC_000913.3 GI:556503834
MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVHHIDHDHTNNPEDGSN
WELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPFADLKAMMNKKK
              
                            

Download fasta file
RegulonDB