RegulonDB RegulonDB 10.9: Amino acid Sequence
Qin prophage; toxic protein HokD Amino Acid Sequence


Size: 51

Fasta

 

>Qin prophage; toxic protein HokD E. coli K12. Version NC_000913.3 GI:556503834
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
              
                            

Download fasta file
RegulonDB