RegulonDB RegulonDB 10.8: Amino acid Sequence
putative c-di-GMP phosphodiesterase PdeA Amino Acid Sequence


Size: 729

Fasta

 

>putative c-di-GMP phosphodiesterase PdeA E. coli K12. Version NC_000913.3 GI:556503834
MFVEHNLIKNIKIFTLAFTLTVVLIQLSRFISPLAIIHSSYIFLAWMPLCVMLSILFIFG
WRGVVPVLCGMFCTNLWNFHLSFLQTAVMLGSQTFVVLCACAILRWQLGTRWRYGLTSRY
VWQRLFWLGLVTPIGIKCSMYLVGSFFDFPLKISTFFGDADAIFTVVDLLSLFTAVLIYN
MLFYYLTRMIVSPHFAQILWRRDIAPSLGKEKRAFTLSWLAALSVLLLLLCTPYENDFIA
GYLVPVFFIIFTLGVGKLRYPFLNLTWAVSTLCLLNYNQNFLQGVETEYSLAFILAVLIS
FSVCLLYMVRIYHRSEWLNRRWHLQALTDPLTLLPNFRALEQAPEQEAGKSFCCLRIDNL
EFMSRHYGLMMRVHCIRSICRTLLPLMQENEKLYQLPGSELLLVLSGPETEGRLQHMVNI
LNSRQIHWNNTGLDMGYGAAWGRFDGNQETLQPLLGQLSWLAEQSCAHHHVLALDSREEM
VSGQTTKQVLLLNTIRTALDQGDLLLYAQPIRNKEGEGYDEILARLKYDGGIMTPDKFLP
LIAQFNLSARFDLQVLESLLKWLATHPCDKKGPRFSVNLMPLTLLQKNIAGRIIRLFKRY
HISPQAVILEITEEQAFSNAESSMYNIEQLHKFGFRIAIDDFGTGYANYERLKRLQADII
KIDGVFVKDIVTNTLDAMIVRSITDLAKAKSLSVVAEFVETQQQQALLHKLGVQYLQGYL
IGRPQPLAD
              
                            

Download fasta file
RegulonDB