RegulonDB RegulonDB 10.10: Amino acid Sequence
ADP-heptose:LPS heptosyltransferase 1 Amino Acid Sequence


Size: 319

Fasta

 

>ADP-heptose:LPS heptosyltransferase 1 E. coli K12. Version NC_000913.3 GI:556503834
MRVLIVKTSSMGDVLHTLPALTDAQQAIPGIKFDWVVEEGFAQIPSWHAAVERVIPVAIR
RWRKAWFSAPIKAERKAFREALQAENYDAVIDAQGLVKSAALVTRLAHGVKHGMDWQTAR
EPLASLFYNRKHHIAKQQHAVERTRELFAKSLGYSKPQTQGDYAIAQHFLTNLPTDAGEY
AVFLHATTRDDKHWPEEHWRELIGLLADSGIRIKLPWGAPHEEERAKRLAEGFAYVEVLP
KMSLEGVARVLAGAKFVVSVDTGLSHLTAALDRPNITVYGPTDPGLIGGYGKNQMVCRAP
RENLINLNSQAVLEKLSSL
              
                            

Download fasta file
RegulonDB