RegulonDB RegulonDB 11.0: Amino acid Sequence
regulator of acetyl CoA synthetase Amino Acid Sequence


Size: 728

Fasta

 

>regulator of acetyl CoA synthetase E. coli K12. Version NC_000913.3 GI:556503834
MITRIPRSSFSANINNTAQTNEHQTLSELFYKELEDKFSGKELATPLLKSFSENCRQNGR
HIFSNKDFVIKFSTSVLQADKKEITIINKNENTTLTQTIAPIFEKYLMEILPQRSDTLDK
QELNLKSDRKEKEFPRIKLNGQCYFPGRPQNRIVCRHIAAQYINDIYQNVDYKPHQDDYS
SAEKFLTHFNKKCKNQTLALVSSRPEGRCVAACGDFGLVMKAYFDKMESNGISVMAAILL
VDNHALTVRLRIKNTTEGCTHYVVSVYDPNVTNDKIRIMSESKENIKHYSLMDFMNVDYS
LLKWSNDHVINQSVAIIPALPKEQLLMLKGSVDEITPPLSPATMNLLMAIGQNHQLTQLM
IQLQKMPELHRTEMLTAYNSINLPGLYLAINYGNADIVETIFNSLSETGYEGLLSKKNLM
HILEAKDKNGFSGLFLAISRKDKNVVTSILNALPKLAATHHLDNEQVYKFLSAKNRTSSH
VLYHVMANGDADMLKIVLNALPLLIRTCHLTKEQVLDLLKAKDFYGCPGLYLAMQNGHSD
IVKVILEALPSLAQEINISASDIVDLLTAKSLARDTGLFMAMQRGHMNVINTIFNALPTL
FNTFKFDKKNMKPLLLANNSNEYPGLFSAIQHKQQNVVETVYLALSDHARLFGFTAEDIM
DFWQHKAPQKYSAFELAFEFGHRVIAELILNTLNKMAESFGFTDNPRYIAEKNYMEALLK
KASPHTVR
              
                            

Download fasta file
RegulonDB