RegulonDB RegulonDB 10.10: Amino acid Sequence
regulator of diguanylate cyclase RdcA Amino Acid Sequence


Size: 742

Fasta

 

>clamp-binding sister replication fork colocalization protein E. coli K12. Version NC_000913.3 GI:556503834
MYTQTLYELSQEAERLLQLSRQQLQLLEKMPLSVPGDDAPQLALPWSQPNIAERHAMLNN
ELRKISRLEMVLAIVGTMKAGKSTTINAIVGTEVLPNRNRPMTALPTLIRHTPGQKEPVL
HFSHVAPIDCLIQQLQQRLRDCDIKHLTDVLEIDKDMRALMQRIENGVAFEKYYLGAQPI
FHCLKSLNDLVRLAKALDVDFPFSAYAAIEHIPVIEVEFVHLAGLESYPGQLTLLDTPGP
NEAGQPHLQKMLNQQLARASAVLAVLDYTQLKSISDEEVREAILAVGQSVPLYVLVNKFD
QQDRNSDDADQVRALISGTLMKGCITPQQIFPVSSMWGYLANRARYELANNGKLPPPEQQ
RWVEDFAHAALGRRWRHADLADLEHIRHAADQLWEDSLFAQPIQALLHAAYANASLYALR
SAAHKLLNYAQQAREYLDFRAHGLNVACEQLRQNIHQIEESLQLLQLNQAQVSGEIKHEI
ELALTSANHFLRQQQDALKVQLAALFQDDSEPLSEIRTRCETLLQTAQNTISRDFTLRFA
ELESTLCRVLTDVIRPIEQQVKMELSESGFRPGFHFPVFHGVVPHFNTRQLFSEVISRQE
ATDEQSTRLGVVRETFSRWLNQPDWGRGNEKSPTETVDYSVLQRALSAEVDLYCQQMAKV
LAEQVDESVTAGMNTFFAEFASCLTELQTRLRESLALRQQNESVVRLMQQQLQQTVMTHG
WIYTDAQLLRDDIQTLFTAERY
              
                            

Download fasta file
RegulonDB