RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF2501 domain-containing protein YjjA Amino Acid Sequence


Size: 164

Fasta

 

>DUF2501 domain-containing protein YjjA E. coli K12. Version NC_000913.3 GI:556503834
MMKTVKHLLCCAIAASALISTGVHAASWKDALSSAASELGNQNSTTQEGGWSLASLTNLL
SSGNQALSADNMNNAAGILQYCAKQKLASVTDAENIKNQVLEKLGLNSEEQKEDTNYLDG
IQGLLKTKDGQQLNLDNIGTTPLAEKVKTKACDLVLKQGLNFIS
              
                            

Download fasta file
RegulonDB