RegulonDB RegulonDB 10.9: Amino acid Sequence
putative succinate exporter YjjB Amino Acid Sequence


Size: 157

Fasta

 

>putative succinate exporter YjjB E. coli K12. Version NC_000913.3 GI:556503834
MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE
WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
              
                            

Download fasta file
RegulonDB