RegulonDB RegulonDB 10.8: Amino acid Sequence
formate dehydrogenase N subunit β Amino Acid Sequence


Size: 294

Fasta

 

>formate dehydrogenase N subunit β E. coli K12. Version NC_000913.3 GI:556503834
MAMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVG
HCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQ
YANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCP
TGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGL
PKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEEDHHE
              
                            

Download fasta file
RegulonDB