RegulonDB RegulonDB 10.8: Amino acid Sequence
sensory histidine kinase RstB Amino Acid Sequence


Size: 433

Fasta

 

>sensory histidine kinase RstB E. coli K12. Version NC_000913.3 GI:556503834
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLN
ERIHFDEGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLVQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPG
IAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFS
WPLWHNIPQFTSA
              
                            

Download fasta file
RegulonDB