RegulonDB RegulonDB 10.8: Amino acid Sequence
putative transporter YcaD Amino Acid Sequence


Size: 382

Fasta

 

>putative transporter YcaD E. coli K12. Version NC_000913.3 GI:556503834
MSTYTQPVMLLLSGLLLLTLAIAVLNTLVPLWLAQEHMSTWQVGVVSSSYFTGNLVGTLL
TGYVIKRIGFNRSYYLASFIFAAGCAGLGLMIGFWSWLAWRFVAGVGCAMIWVVVESALM
CSGTSRNRGRLLAAYMMVYYVGTFLGQLLVSKVSTELMSVLPWVTGLTLAGILPLLFTRV
LNQQAENHDSTSITSMLKLRQARLGVNGCIISGIVLGSLYGLMPLYLNHKGVSNASIGFW
MAVLVSAGILGQWPIGRLADKFGRLLVLRVQVFVVILGSIAMLSQAAMAPALFILGAAGF
TLYPVAMAWACEKVEHHQLVAMNQALLLSYTVGSLLGPSFTAMLMQNFSDNLLFIMIASV
SFIYLLMLLRNAGHTPKPVAHV
              
                            

Download fasta file
RegulonDB