RegulonDB RegulonDB 10.9: Amino acid Sequence
universal stress protein E Amino Acid Sequence


Size: 316

Fasta

 

>universal stress protein with a role cellular motility E. coli K12. Version NC_000913.3 GI:556503834
MAMYQNMLVVIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTTLLSPDERTAM
RQGVISQRTAWIHEQAKYYLNAGVPIEIKVVWHNRPFEAIIQEVISGGHDLVLKMAHQHD
RLEAVIFTPTDWHLLRKCPSPVWMVKDQPWPEGGKALVAVNLASEEPYHNALNEKLVKET
IELAEQVNHTEVHLVGAYPVTPINIAIELPEFDPSVYNDAIRGQHLLAMKALRQKFGINE
NMTHVEKGLPEEVIPDLAEHLQAGIVVLGTVGRTGISAAFLGNTAEQVIDHLRCDLLVIK
PDQYQTPVELDDEEDD
              
                            

Download fasta file
RegulonDB