RegulonDB RegulonDB 10.8: Amino acid Sequence
endoribonuclease toxin MazF Amino Acid Sequence


Size: 111

Fasta

 

>endoribonuclease toxin MazF E. coli K12. Version NC_000913.3 GI:556503834
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPF
EVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIG
              
                            

Download fasta file
RegulonDB