RegulonDB RegulonDB 10.7: Amino acid Sequence
hydrogenase 4 component B Amino Acid Sequence


Size: 672

Fasta

 

>hydrogenase 4 component B E. coli K12. Version NC_000913.3 GI:556503834
MDALQLLTWSLILYLFASLASLFLLGLDRLAIKLSGITSLVGGVIGIISGITQLHAGVTL
VARFAPPFEFADLTLRMDSLSAFMVLVISLLVVVCSLYSLTYMREYEGKGAAAMGFFMNI
FIASMVALLVMDNAFWFIVLFEMMSLSSWFLVIARQDKTSINAGMLYFFIAHAGSVLIMI
AFLLMGRESGSLDFASFRTLSLSPGLASAVFLLAFFGFGAKAGMMPLHSWLPRAHPAAPS
HASALMSGVMVKIGIFGILKVAMDLLAQTGLPLWWGILVMAIGAISALLGVLYALAEQDI
KRLLAWSTVENVGIILLAVGVAMVGLSLHDPLLTVVGLLGALFHLLNHALFKGLLFLGAG
AIISRLHTHDMEKMGALAKRMPWTAAACLIGCLAISAIPPLNGFISEWYTWQSLFSLSRV
EAVALQLAGPIAMVMLAVTGGLAVMCFVKMYGITFCGAPRSTHAEEAQEVPNTMIVAMLL
LAALCVLIALSASWLAPKIMHIAHAFTNTPPATVASGIALVPGTFHTQVTPSLLLLLLLA
MPLLPGLYWLWCRSRRAAFRRTGDAWACGYGWENAMAPSGNGVMQPLRVVFSALFRLRQQ
LDPTLRLNKGLAHVTARAQSTEPFWDERVIRPIVSATQRLAKEIQHLQSGDFRLYCLYVV
AALVVLLIAIAV
              
                            

Download fasta file
RegulonDB