RegulonDB RegulonDB 10.8: Amino acid Sequence
4-aminobutanoate:H+ symporter Amino Acid Sequence


Size: 466

Fasta

 

>4-aminobutanoate:H+ symporter E. coli K12. Version NC_000913.3 GI:556503834
MGQSSQPHELGGGLKSRHVTMLSIAGVIGASLFVGSSVAIAEAGPAVLLAYLFAGLLVVM
IMRMLAEMAVATPDTGSFSTYADKAIGRWAGYTIGWLYWWFWVLVIPLEANIAAMILHSW
VPGIPIWLFSLVITLALTGSNLLSVKNYGEFEFWLALCKVIAILAFIFLGAVAISGFYPY
AEVSGISRLWDSGGFMPNGFGAVLSAMLITMFSFMGAEIVTIAAAESDTPEKHIVRATNS
VIWRISIFYLCSIFVVVALIPWNMPGLKAVGSYRSVLELLNIPHAKLIMDCVILLSVTSC
LNSALYTASRMLYSLSRRGDAPAVMGKINRSKTPYVAVLLSTGAAFLTVVVNYYAPAKVF
KFLIDSSGAIALLVYLVIAVSQLRMRKILRAEGSEIRLRMWLYPWLTWLVIGFITFVLVV
MLFRPAQQLEVISTGLLAIGIICTVPIMARWKKLVLWQKTPVHNTR
              
                            

Download fasta file
RegulonDB