RegulonDB RegulonDB 10.9: Amino acid Sequence
lipopolysaccharide glucosyltransferase I Amino Acid Sequence


Size: 374

Fasta

 

>lipopolysaccharide glucosyltransferase I E. coli K12. Version NC_000913.3 GI:556503834
MIVAFCLYKYFPFGGLQRDFMRIASTVAARGHHVRVYTQSWEGDCPKAFELIQVPVKSHT
NHGRNAEYYAWVQNHLKEHPADRVVGFNKMPGLDVYFAADVCYAEKVAQEKGFLYRLTSR
YRHYAAFERATFEQGKSTKLMMLTDKQIADFQKHYQTEPERFQILPPGIYPDRKYSEQIP
NSREIYRQKNGIKEQQNLLLQVGSDFGRKGVDRSIEALASLPESLRHNTLLFVVGQDKPR
KFEALAEKLGVRSNVHFFSGRNDVSELMAAADLLLHPAYQEAAGIVLLEAITAGLPVLTT
AVCGYAHYIADANCGTVIAEPFSQEQLNEVLRKALTQSPLRMAWAENARHYADTQDLYSL
PEKAADIITGGLDG
              
                            

Download fasta file
RegulonDB