RegulonDB RegulonDB 10.9: Amino acid Sequence
UDP-glucose:(glucosyl)LPS α-1,2-glucosyltransferase Amino Acid Sequence


Size: 338

Fasta

 

>UDP-glucose:(glucosyl)LPS α-1,2-glucosyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MDSFPAIEIDKVKAWDFRLANINTSECLNVAYGVDANYLDGVGVSITSIVLNNRHINLDF
YIIADVYNDGFFQKIAKLAEQNQLRITLYRINTDKLQCLPCTQVWSRAMYFRLFAFQLLG
LTLDRLLYLDADVVCKGDISQLLHLGLNGAVAAVVKDVEPMQEKAVSRLSDPELLGQYFN
SGVVYLDLKKWADAKLTEKALSILMSKDNVYKYPDQDVMNVLLKGMTLFLPREYNTIYTI
KSELKDKTHQNYKKLITESTLLIHYTGATKPWHKWAIYPSVKYYKIALENSPWKDDSPRD
AKSIIEFKKRYKHLLVQHHYISGIIAGVCYLCRKYYRK
              
                            

Download fasta file
RegulonDB