RegulonDB RegulonDB 10.9: Amino acid Sequence
putative assembly protein AsmA Amino Acid Sequence


Size: 617

Fasta

 

>putative assembly protein AsmA E. coli K12. Version NC_000913.3 GI:556503834
MRRFLTTLMILLVVLVAGLSALVLLVNPNDFRDYMVKQVAARSGYQLQLDGPLRWHVWPQ
LSILSGRMSLTAQGASQPLVRADNMRLDVALLPLLSHQLSVKQVMLKGAVIQLTPQTEAV
RSEDAPVAPRDNTLPDLSDDRGWSFDISSLKVADSVLVFQHEDDEQVTIRNIRLQMEQDP
QHRGSFEFSGRVNRDQRDLTISLNGTVDASDYPHDLTAAIEQINWQLQGADLPKQGIQGQ
GSFQAQWQESHKRLSFNQISLTANDSTLSGQAQVTLTEKPEWQLRLQFPQLNLDNLIPLN
ETANGENGAAQQGQSQSTLPRPVISSRIDEPAYQGLQGFTADILLQASNVRWRGMNFTDV
ATQMTNKSGLLEITQLQGKLNGGQVSLPGTLDATSINPRINFQPRLENVEIGTILKAFNY
PISLTGKMSLAGDFSGADIDADAFRHNWQGQAHVEMTDTRMEGMNFQQMIQQAVERNGGD
VKAAENFDNVTRLDRFTTDLTLKDGVVTLNDMQGQSPVLALTGEGMLNLADQTCDTQFDI
RVVGGWNGESKLIDFLKETPVPLRVYGNWQQLNYSLQVDQLLRKHLQDEAKRRLNDWAER
NKDSRNGKDVKKLLEKM
              
                            

Download fasta file
RegulonDB