RegulonDB RegulonDB 10.8: Amino acid Sequence
tRNA adenosine34 deaminase Amino Acid Sequence


Size: 167

Fasta

 

>tRNA adenosine34 deaminase E. coli K12. Version NC_000913.3 GI:556503834
MSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEI
MALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDV
LHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD
              
                            

Download fasta file
RegulonDB