RegulonDB RegulonDB 10.8: Amino acid Sequence
membrane-bound lytic murein transglycosylase F Amino Acid Sequence


Size: 518

Fasta

 

>membrane-bound lytic murein transglycosylase F E. coli K12. Version NC_000913.3 GI:556503834
MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEIN
GKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQ
PGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVD
DKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNT
LSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAE
EIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYL
QDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQ
KPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTE
LGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN
              
                            

Download fasta file
RegulonDB