RegulonDB RegulonDB 10.9: Amino acid Sequence
alkyl hydroperoxide reductase, AhpC component Amino Acid Sequence


Size: 187

Fasta

 

>alkyl hydroperoxide reductase, AhpC component E. coli K12. Version NC_000913.3 GI:556503834
MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTFVCPTELGDVADHYEE
LQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGALTRNFDNMREDEGLADR
ATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPGEVCPAKWKEGEATLAPS
LDLVGKI
              
                            

Download fasta file
RegulonDB