RegulonDB RegulonDB 10.10: Amino acid Sequence
periplasmic acid stress chaperone HdeA Amino Acid Sequence


Size: 110

Fasta

 

>periplasmic acid stress chaperone HdeA E. coli K12. Version NC_000913.3 GI:556503834
MKKVLGVILGGLLLLPVVSNAADAQKAADNKKPVNSWTCEDFLAVDESFQPTAVGFAEAL
NNKDKPEDAVLDVQGIATVTPAIVQACTQDKQANFKDKVKGEWDKIKKDM
              
                            

Download fasta file
RegulonDB