RegulonDB RegulonDB 10.10: Amino acid Sequence
O-antigen ligase Amino Acid Sequence


Size: 419

Fasta

 

>O-antigen ligase E. coli K12. Version NC_000913.3 GI:556503834
MLTSFKLHSLKPYTLKSSMILEIITYILCFFSMIIAFVDNTFSIKIYNITAIVCLLSLIL
RGRQENYNIKNLILPLSIFLIGLLDLIWYSAFKVDNSPFRATYHSYLNTAKIFIFGSFIV
FLTLTSQLKSKKESVLYTLYSLSFLIAGYAMYINSIHENDRISFGVGTATGAAYSTMLIG
IVSGVAILYTKKNHPFLFLLNSCAVLYVLALTQTRATLLLFPIICVAALIAYYNKSPKKF
TSSIVLLIAILASIVIIFNKPIQNRYNEALNDLNSYTNANSVTSLGARLAMYEIGLNIFI
KSPFSFRSAESRAESMNLLVAEHNRLRGALEFSNVHLHNEIIEAGSLKGLMGIFSTLFLY
FSLFYIAYKKRALGLLILTLGIVGIGLSDVIIWARSIPIIIISAIVLLLVINNRNNTIN
              
                            

Download fasta file
RegulonDB