RegulonDB RegulonDB 10.8: Amino acid Sequence
putative DNA-binding transcriptional regulator YfeD Amino Acid Sequence


Size: 130

Fasta

 

>putative DNA-binding transcriptional regulator YfeD E. coli K12. Version NC_000913.3 GI:556503834
MKRLRNKMTTEELAECLGVAKQTVNRWIREKGWKTEKFPGVKGGRARLILVDTQVCEFIQ
NTPAFHNTPMLMEAEERIAEYAPGARAPAYRQIINAIDNMTDIEQEKVAQFLSREGIRNF
LARLDIDESA
              
                            

Download fasta file
RegulonDB