RegulonDB RegulonDB 10.8: Amino acid Sequence
m7GTP pyrophosphatase Amino Acid Sequence


Size: 194

Fasta

 

>m7GTP pyrophosphatase E. coli K12. Version NC_000913.3 GI:556503834
MPKLILASTSPWRRALLEKLQISFECAAPEVDETPRSDESPRQLVLRLAQEKAQSLASRY
PDHLIIGSDQVCVLDGEITGKPLTEENARLQLRKASGNIVTFYTGLALFNSANGHLQTEV
EPFDVHFRHLSEAEIDNYVRKEHPLHCAGSFKSEGFGITLFERLEGRDPNTLVGLPLIAL
CQMLRREGKNPLMG
              
                            

Download fasta file
RegulonDB