RegulonDB RegulonDB 11.0: Amino acid Sequence
acid-resistance membrane protein Amino Acid Sequence


Size: 190

Fasta

 

>acid-resistance membrane protein E. coli K12. Version NC_000913.3 GI:556503834
MLYIDKATILKFDLEMLKKHRRAIQFIAVLLFIVGLLCISFPFVSGDILSTVVGALLICS
GIALIVGLFSNRSHNFWPVLSGFLVAVAYLLIGYFFIRAPELGIFAIAAFIAGLFCVAGV
IRLMSWYRQRSMKGSWLQLVIGVLDIVIAWIFLGATPMVSVTLVSTLVGIELIFSAASLF
SFASLFVKQQ
              
                            

Download fasta file
RegulonDB