RegulonDB RegulonDB 10.9: Amino acid Sequence
23S rRNA 2'-O-ribose U2552 methyltransferase Amino Acid Sequence


Size: 209

Fasta

 

>23S rRNA 2'-O-ribose U2552 methyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MTGKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQSDKLFKPGMTVVDLGA
APGGWSQYVVTQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVMKALLERVGDSKVQV
VMSDMAPNMSGTPAVDIPRAMYLVELALEMCRDVLAPGGSFVVKVFQGEGFDEYLREIRS
LFTKVKVRKPDSSRARSREVYIVATGRKP
              
                            

Download fasta file
RegulonDB