RegulonDB RegulonDB 10.8: Amino acid Sequence
DNA-binding transcriptional repressor StpA with RNA chaperone activity Amino Acid Sequence


Size: 134

Fasta

 

>DNA-binding transcriptional repressor StpA with RNA chaperone activity E. coli K12. Version NC_000913.3 GI:556503834
MSVMLQSLNNIRTLRAMAREFSIDVLEEMLEKFRVVTKERREEEEQQQRELAERQEKIST
WLELMKADGINPEELLGNSSAAAPRAGKKRQPRPAKYKFTDVNGETKTWTGQGRTPKPIA
QALAEGKSLDDFLI
              
                            

Download fasta file
RegulonDB