RegulonDB RegulonDB 10.8: Amino acid Sequence
putative electron transfer flavoprotein FixB Amino Acid Sequence


Size: 313

Fasta

 

>putative electron transfer flavoprotein FixB E. coli K12. Version NC_000913.3 GI:556503834
MNTFSQVWVFSDTPSRLPELMNGAQALANQINTFVLNDADGAQAIQLGANHVWKLNGKPD
DRMIEDYAGVMADTIRQHGADGLVLLPNTRRGKLLAAKLGYRLKAAVSNDASTVSVQDGK
ATVKHMVYGGLAIGEERIATPYAVLTISSGTFDAAQPDASRTGETHTVEWQAPAVAITRT
ATQARQSNSVDLDKARLVVSVGRGIGSKENIALAEQLCKAIGAELACSRPVAENEKWMEH
ERYVGISNLMLKPELYLAVGISGQIQHMVGANASQTIFAINKDKNAPIFQYADYGIVGDA
VKILPALTAALAR
              
                            

Download fasta file
RegulonDB