RegulonDB RegulonDB 10.8: Amino acid Sequence
putative ferredoxin FixX Amino Acid Sequence


Size: 95

Fasta

 

>putative ferredoxin FixX E. coli K12. Version NC_000913.3 GI:556503834
MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPAGLYKKQDDGSVRFDY
AGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG
              
                            

Download fasta file
RegulonDB