RegulonDB RegulonDB 10.8: Amino acid Sequence
multiple antibiotic resistance protein Amino Acid Sequence


Size: 72

Fasta

 

>multiple antibiotic resistance protein E. coli K12. Version NC_000913.3 GI:556503834
MKPLSSAIAAALILFSAQGVAEQTTQPVVTSCANVVVVPPSQEHPPFDLNHMGTGSDKSD
ALGVPYYNQHAM
              
                            

Download fasta file
RegulonDB