RegulonDB RegulonDB 10.8: Amino acid Sequence
putative ABC transporter periplasmic binding protein ArtI Amino Acid Sequence


Size: 243

Fasta

 

>putative ABC transporter periplasmic binding protein ArtI E. coli K12. Version NC_000913.3 GI:556503834
MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVGFDVDLAQALCKEIDA
TCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTS
VDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTE
WLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNTALEKVKKDGTYETIYNKW
FQK
              
                            

Download fasta file
RegulonDB