RegulonDB RegulonDB 10.8: Amino acid Sequence
putrescine ABC transporter membrane subunit PotI Amino Acid Sequence


Size: 281

Fasta

 

>putrescine ABC transporter membrane subunit PotI E. coli K12. Version NC_000913.3 GI:556503834
MNNLPVVRSPWRIVILLLGFTFLYAPMLMLVIYSFNSSKLVTVWAGWSTRWYGELLRDDA
MMSAVGLSLTIAACAATAAAILGTIAAVVLVRFGRFRGSNGFAFMITAPLVMPDVITGLS
LLLLFVALAHAIGWPADRGMLTIWLAHVTFCTAYVAVVISSRLRELDRSIEEAAMDLGAT
PLKVFFVITLPMIMPAIISGWLLAFTLSLDDLVIASFVSGPGATTLPMLVFSSVRMGVNP
EINALATLILGAVGIVGFIAWYLMARAEKQRIRDIQRARRG
              
                            

Download fasta file
RegulonDB