RegulonDB RegulonDB 10.8: Amino acid Sequence
acetyl-CoA carboxyltransferase subunit α Amino Acid Sequence


Size: 319

Fasta

 

>acetyl-CoA carboxyltransferase subunit α E. coli K12. Version NC_000913.3 GI:556503834
MSLNFLDFEQPIAELEAKIDSLTAVSRQDEKLDINIDEEVHRLREKSVELTRKIFADLGA
WQIAQLARHPQRPYTLDYVRLAFDEFDELAGDRAYADDKAIVGGIARLDGRPVMIIGHQK
GRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTPGAYPGVGAEERGQSEA
IARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKS
ADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLADLADLDVL
STEDLKNRRYQRLMSYGYA
              
                            

Download fasta file
RegulonDB