RegulonDB RegulonDB 11.1: Amino acid Sequence
cyclic pyranopterin monophosphate synthase Amino Acid Sequence


Size: 161

Fasta

 

>cyclic pyranopterin monophosphate synthase E. coli K12. Version NC_000913.3 GI:556503834
MSQLTHINAAGEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARI
AGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAAS
VAALTIYDMCKAVQKDMVIGPVRLLAKSGGKSGDFKVEADD
              
                            

Download fasta file
RegulonDB